Structure of PDB 7q08 Chain AK Binding Site BS02

Receptor Information

>7q08 Chain AK (length=86) Species: 237561 (Candida albicans SC5314)

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

Ligand information

>7q08 Chain 4 (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
• Resolution: 2.56 Å
• Binding residue (original residue number in PDB): R21 C22 V29 T59 G60 G62 R63 M64 Y66 L67 K68 V70 R72 F74 K75 N76 Q79 T80 G81 V82 A83 Q86
• Binding residue (residue number reindexed from 1): R20 C21 V28 T58 G59 G61 R62 M63 Y65 L66 K67 V69 R71 F73 K74 N75 Q78 T79 G80 V81 A82 Q85

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q08, PDBe:7q08, PDBj:7q08
• PDBsum: 7q08
• PubMed: 35613268
• UniProt: A0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)