Structure of PDB 7lh5 Chain AK Binding Site BS02

Receptor Information
>7lh5 Chain AK (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
Ligand information
>7lh5 Chain AW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
...<<<...<<<<........>>>>..<<<<<.....>>>>>........
<...........>...>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lh5 Structural basis for plazomicin antibiotic action and resistance.
Resolution3.27 Å
Binding residue
(original residue number in PDB)		K51 R54
Binding residue
(residue number reindexed from 1)		K41 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
PDBsum7lh5
PubMed34117352
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]