Structure of PDB 4v6l Chain AK Binding Site BS02

Receptor Information
>4v6l Chain AK (length=178) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AHYRWLSLRSFSHQAGASSKQPALGYLN
Ligand information
>4v6l Chain AD (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuauguuuuuuuuuugauuugcc
........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6l Structural insights into cognate versus near-cognate discrimination during decoding.
Resolution13.2 Å
Binding residue
(original residue number in PDB)
G81 S82 Y84 A149 F150 A151 W155 L158 R159 S160 F161 S162 G166 A167 S168
Binding residue
(residue number reindexed from 1)
G81 S82 Y84 A149 F150 A151 W155 L158 R159 S160 F161 S162 G166 A167 S168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
PDBsum4v6l
PubMed21378755
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]