Structure of PDB 8evr Chain AJ Binding Site BS02

Receptor Information

>8evr Chain AJ (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

Ligand information

>8evr Chain A3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8evr Regulation of translation by ribosomal RNA pseudouridylation.
Resolution	2.87 Å
Binding residue (original residue number in PDB)	N7 M9 R10 Q43 T44 V46 V69 T70 R72 G135 R137 R140 R141 R143 T147 G149 N150 S151 H152
Binding residue (residue number reindexed from 1)	N2 M4 R5 Q38 T39 V41 V64 T65 R67 G130 R132 R135 R136 R138 T142 G144 N145 S146 H147

Enzymatic activity

Enzyme Commision number

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3
Tue May 13 01:59:48 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

/var/www/html/BioLiP/pdb.cgi in <module>()

1701 title=pdb2title(pdbid)

1702 if bs.startswith("BS"):

=> 1703 pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

1704 else:

1705 if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8evr', asym_id = 'AJ', bs = 'BS02', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'

/var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8evr', asym_id='AJ', bs='BS02', title='Regulation of translation by ribosomal RNA pseudouridylation.')

1326 display_ec(ec,csaOrig,csaRenu)

1327 if go:

=> 1328 display_go(go,uniprot,pdbid,asym_id)

1329 return pubmed,uniprot

1330

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8evr', asym_id = 'AJ'

/var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8evr', asym_id='AJ')

484 '''.replace("$namespace_link",namespace_link

485 ).replace("$namespace",namespace

=> 486 ).replace("$uniprot",u

487 ))

488 for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
args = ("local variable 'u' referenced before assignment",)
with_traceback = <built-in method with_traceback of UnboundLocalError object>