Structure of PDB 6q8y Chain AJ Binding Site BS02

Receptor Information

>6q8y Chain AJ (length=193) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

Ligand information

>6q8y Chain BS (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6q8y Structure of the 80S ribosome-Xrn1 nuclease complex.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	F26 S34
Binding residue (residue number reindexed from 1)	F25 S33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6q8y, PDBe:6q8y, PDBj:6q8y
PDBsum	6q8y
PubMed	30911188
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]