Structure of PDB 8oeq Chain AI Binding Site BS02

Receptor Information
>8oeq Chain AI (length=120) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIHTVRKN
IARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASQE
TEKARKQRIAFPQRKFAIKA
Ligand information
>8oeq Chain 4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Resolution3.3 Å
Binding residue
(original residue number in PDB)		M1 A2 K5 T6 F7 K35 S40 P42 H45 R48 K49 A52 R53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89
Binding residue
(residue number reindexed from 1)		M1 A2 K5 T6 F7 K35 S40 P42 H45 R48 K49 A52 R53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89
External links