Structure of PDB 7q0p Chain AI Binding Site BS02

Receptor Information
>7q0p Chain AI (length=119) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIHTVRKNI
ARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASQET
EKARKQRIAFPQRKFAIKA
Ligand information
>7q0p Chain 4 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution2.77 Å
Binding residue
(original residue number in PDB)
A2 G3 K5 T6 F7 R10 K35 R43 H45 R48 K49 A52 R53 L55 T56 N59 L60 R63 K78 A82 K83 T85 R86 R89
Binding residue
(residue number reindexed from 1)
A1 G2 K4 T5 F6 R9 K34 R42 H44 R47 K48 A51 R52 L54 T55 N58 L59 R62 K77 A81 K82 T84 R85 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum7q0p
PubMed35613268
UniProtA0A1D8PK30|RL35_CANAL Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]