Structure of PDB 4v6o Chain AI Binding Site BS02

Receptor Information
>4v6o Chain AI (length=135) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS
PMVKAKDERRERRDDFANETADDAEAGDSEEEEEE
Ligand information
>4v6o Chain AC (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggauaagugcauuauguuuauguggugauuugcccuucuguagcca
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6o Structural characterization of mRNA-tRNA translocation intermediates.
Resolution14.7 Å
Binding residue
(original residue number in PDB)		R45 Q46 L47 A48 E108 R112 R113
Binding residue
(residue number reindexed from 1)		R45 Q46 L47 A48 E108 R112 R113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum4v6o
PubMed22467828
UniProtP02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]