Structure of PDB 4v6o Chain AH Binding Site BS02

Receptor Information
>4v6o Chain AH (length=166) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYG
KAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASE
GTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPE
MVAAKRGKSVEEILGK
Ligand information
>4v6o Chain AC (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggauaagugcauuauguuuauguggugauuugcccuucuguagcca
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6o Structural characterization of mRNA-tRNA translocation intermediates.
Resolution14.7 Å
Binding residue
(original residue number in PDB)		I3 E4 K5 Q6 A7 G8 E9 L10 V17 N18 R19 R28 F30 F32 R44 V55 P56 I59 M63 R67 R68
Binding residue
(residue number reindexed from 1)		I3 E4 K5 Q6 A7 G8 E9 L10 V17 N18 R19 R28 F30 F32 R44 V55 P56 I59 M63 R67 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum4v6o
PubMed22467828
UniProtP0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]