Structure of PDB 4v79 Chain AG Binding Site BS02

Receptor Information

>4v79 Chain AG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA

Ligand information

>4v79 Chain A2 (length=15) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acuaugguuuuuauu

...............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v79 Energy barriers and driving forces in tRNA translocation through the ribosome.
Resolution	15.0 Å
Binding residue (original residue number in PDB)	G81 S82 T83 Y84 E145 A146 A149 F150
Binding residue (residue number reindexed from 1)	G80 S81 T82 Y83 E144 A145 A148 F149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v79, PDBe:4v79, PDBj:4v79
PDBsum	4v79
PubMed	24186064
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]