Structure of PDB 3jbn Chain AG Binding Site BS02

Receptor Information
>3jbn Chain AG (length=124) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRKISCFV
TVRGKKALEILEKGLKRRKNFSDTGNFGFGIGMDFYVHLSRSGYRVTRRT
RRRSKISKTHKVTKEDAMKWFQTK
Ligand information
>3jbn Chain AB (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacucguucauacuacaguggauacaccagaucccaucagaacucugaag
uuaagcacuguaaggcuuggcuaguacugaggugggagaccgcucgggaa
caccaggugaugagucag
<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..>
>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>...
..>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		M9 R10 K44 I46 V69 T70 R72 G135 R137 R140 R141 T142 R144 S146 K150 H152
Binding residue
(residue number reindexed from 1)		M2 R3 K37 I39 V50 T51 R53 G93 R95 R98 R99 T100 R102 S104 K108 H110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtQ8IBQ6

[Back to BioLiP]