Structure of PDB 7p5x Chain AF Binding Site BS02

Receptor Information

>7p5x Chain AF (length=318) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYA
TQKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKR
YTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAM
ADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEK
VLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQ
LQSVLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESK
TMSKLRHPSRSQVLRDYL

Ligand information

>7p5x Chain AP (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tccgatcggtaccggacatgtaaagagcagaccaccgacaagt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7p5x Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	R247 R251 R290 N315 I359 S371 F376
Binding residue (residue number reindexed from 1)	R100 R104 R143 N168 I212 S224 F229

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7p5x, PDBe:7p5x, PDBj:7p5x
PDBsum	7p5x
PubMed	34851662
UniProt	A0QW02

[Back to BioLiP]