Structure of PDB 4v6o Chain AF Binding Site BS02

Receptor Information
>4v6o Chain AF (length=232) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
Ligand information
>4v6o Chain AC (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggauaagugcauuauguuuauguggugauuugcccuucuguagcca
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6o Structural characterization of mRNA-tRNA translocation intermediates.
Resolution14.7 Å
Binding residue
(original residue number in PDB)		R126 V127 F129 R130 R131 K134 Q138 G157 R163 T164 E165 W166
Binding residue
(residue number reindexed from 1)		R126 V127 F129 R130 R131 K134 Q138 G157 R163 T164 E165 W166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum4v6o
PubMed22467828
UniProtP0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]