Structure of PDB 6zu1 Chain AE Binding Site BS02

Receptor Information

>6zu1 Chain AE (length=156) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPAMVAAKRGK
SVEEIL

Ligand information

>6zu1 Chain AV (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucauguucacauaccaaacggcgcgcg

...........................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6zu1 Structural basis of transcription-translation coupling and collision in bacteria.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	L15 R20 F31 F33 V56 I60
Binding residue (residue number reindexed from 1)	L6 R11 F22 F24 V47 I51

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zu1, PDBe:6zu1, PDBj:6zu1
PDBsum	6zu1
PubMed	32820062
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]