Structure of PDB 4v4y Chain AE Binding Site BS02

Receptor Information
>4v4y Chain AE (length=234) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFR
FIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFK
TISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLK
RLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDD
AIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQ
Ligand information
>4v4y Chain A1 (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuggcaaggagguuuuuuuuuuuuuuuuuuuuuuu
..................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
Resolution5.5 Å
Binding residue
(original residue number in PDB)		G14 V15 F17 H19 N37 Q76 D206
Binding residue
(residue number reindexed from 1)		G8 V9 F11 H13 N31 Q70 D200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtP80371|RS2_THET8 Small ribosomal subunit protein uS2 (Gene Name=rpsB)

[Back to BioLiP]