Structure of PDB 4v4n Chain AE Binding Site BS02

Receptor Information
>4v4n Chain AE (length=186) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAVEIPNKEQILADWEAHPMRRPRIEKVTINIGVGESGERLTKAEIMLQQ
LTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYELLKRLLAAVDN
RLKASSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRV
ARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEG
Ligand information
>4v4n Chain A3 (length=126) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggcggccauagcgggggggccacacccggucucauuucgaacccggaag
uuaagccccccagcgaucccgguuguacugcccuccgagagggggcggga
agccggggacgccgccggccacuauc
.<<<<<.....<<<<<<<......<<<<<<.............>>>>..>
>.....>>>>>.>>..<<<<<<<....<<<<<<.<<....>>>>>>>>..
.>>>>>>>...>>>>>..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4n Structure of the SecY channel during initiation of protein translocation.
Resolution9.0 Å
Binding residue
(original residue number in PDB)		H18 R21 Q54 K55 P56 I57 K79 V80 T81 R83 P146 G147 R149 V150 R152 R153 K154 A158 I160 R163 H164
Binding residue
(residue number reindexed from 1)		H18 R21 Q54 K55 P56 I57 K79 V80 T81 R83 P146 G147 R149 V150 R152 R153 K154 A158 I160 R163 H164
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Mar 7 09:10:57 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v4n', asym_id = 'AE', bs = 'BS02', title = 'Structure of the SecY channel during initiation of protein translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v4n', asym_id='AE', bs='BS02', title='Structure of the SecY channel during initiation of protein translocation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4n', asym_id = 'AE'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4n', asym_id='AE')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>