Structure of PDB 8evt Chain AD Binding Site BS02

Receptor Information
>8evt Chain AD (length=292) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRF
TNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLI
ARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTT
GARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVS
QYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKP
TEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>8evt Chain A3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8evt Regulation of translation by ribosomal RNA pseudouridylation.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 V52 R54 T56 N57 K58 Q63 I65 I69 T70 G71 D72 V74 G91 N94 W95 Q151 R152 T155 A157 R158 F185 Y198 H203 Y207 E221 L222 F223 K224 F253 T256 K258 K259 F260 K262 Y265 A266 E268 S269 Y272 R273 Q274 K276 L277 K279 R282 R285 V286
Binding residue
(residue number reindexed from 1)		K3 S5 S8 S9 F11 T13 F15 R16 R17 R19 T23 Y25 R28 R45 V47 R49 T51 N52 K53 Q58 I60 I64 T65 G66 D67 V69 G86 N89 W90 Q146 R147 T150 A152 R153 F180 Y193 H198 Y202 E216 L217 F218 K219 F248 T251 K253 K254 F255 K257 Y260 A261 E263 S264 Y267 R268 Q269 K271 L272 K274 R277 R280 V281
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 22:35:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8evt', asym_id = 'AD', bs = 'BS02', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8evt', asym_id='AD', bs='BS02', title='Regulation of translation by ribosomal RNA pseudouridylation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '8evt', asym_id = 'AD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='8evt', asym_id='AD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>