Structure of PDB 7qi4 Chain AD Binding Site BS02

Receptor Information
>7qi4 Chain AD (length=343) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT
Ligand information
>7qi4 Chain Az (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuaaaugguuguuuauaaaaaaauuuacuuaaa
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qi4 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		K112 G113 R128 W179 R189 S197 W198 I201 F229 R237 K239 R264
Binding residue
(residue number reindexed from 1)		K25 G26 R41 W92 R102 S110 W111 I114 F142 R150 K152 R177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi4, PDBe:7qi4, PDBj:7qi4
PDBsum7qi4
PubMed38769321
UniProtP82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)

[Back to BioLiP]