Structure of PDB 7mpi Chain AD Binding Site BS02

Receptor Information
>7mpi Chain AD (length=292) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRF
TNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLI
ARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTT
GARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVS
QYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKP
TEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7mpi Chain A3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mpi CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I65 I69 G71 D72 V74 Y79 H90 G91 N94 W95 T154 T155 R158 Y198 H203 Y207 E210 R218 E221 K224 F253 T256 K258 K259 F260 Y265 A266 E268 S269 K270 Y272 R273 Q274 T275 K276 L277 K279 R282 R285 V286 K289
Binding residue
(residue number reindexed from 1)		K3 S5 S8 S9 F11 T13 F15 R16 R17 R19 K22 T23 Y25 R28 R45 R49 T51 N52 K53 I56 Q58 I60 I64 G66 D67 V69 Y74 H85 G86 N89 W90 T149 T150 R153 Y193 H198 Y202 E205 R213 E216 K219 F248 T251 K253 K254 F255 Y260 A261 E263 S264 K265 Y267 R268 Q269 T270 K271 L272 K274 R277 R280 V281 K284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mpi, PDBe:7mpi, PDBj:7mpi
PDBsum7mpi
PubMed35489333
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]