BioLiP

Receptor Information

>6uz7 Chain AD (length=295) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLV
VRFTNKDIITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATG
LLLARRTLQKLGLDETYPGVEEVEGEYELTEAVEDGPRPFKVYLDVGLQR
TTTGARIFGALKGASDGGLYVPHSENRFPGWDFEAEELDADLLRTYIFGG
HVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIYADAHAAIREDPA
FKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKISALAPQE

>6uz7 Chain 7 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	K8 S10 H13 S14 Y16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 Q63 I69 T70 D72 V74 Y79 G91 N94 R152 T155 A157 R158 Y198 H203 Y207 E210 R218 L222 K224 F253 Q264 Y265 A266 E268 S269 Y272 R273 K276 L277
Binding residue (residue number reindexed from 1)	K6 S8 H11 S12 Y14 T16 F18 R19 R20 R22 T26 Y28 R31 R48 R52 T54 N55 Q61 I67 T68 D70 V72 Y77 G89 N92 R150 T153 A155 R156 Y196 H201 Y205 E208 R216 L220 K222 F251 Q262 Y263 A264 E266 S267 Y270 R271 K274 L275

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
PDBsum	6uz7
PubMed	31900355
UniProt	Q6CRR9

[Back to BioLiP]

Structure of PDB 6uz7 Chain AD Binding Site BS02