Structure of PDB 8apn Chain AC Binding Site BS02

Receptor Information
>8apn Chain AC (length=139) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VFAEVKPRQNPQNHTHEKYKIIAPQPKYDWLVGRFIVDRNNVVWHRQANR
NRNRHKKTAGALTRLKRWKPLHKAYAKKLLKLGFKRRFWTDPDPQMVPGF
FDPSKYKPRERLNGKPNLRPDIGCPALRQSQRPLKKLPR
Ligand information
>8apn Chain A2 (length=81) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauaaauaaguuuaauaccuuuugcagcauggaccagcgauuaaaugccg
guaauuagcaaaguuaaacuaacgaaaaaua
..<<<<<..>>>>>...<.<........>.>...................
.....<<<<...>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		I87 G148
Binding residue
(residue number reindexed from 1)		I22 G83
External links