Structure of PDB 7wg5 Chain AC Binding Site BS02

Receptor Information

>7wg5 Chain AC (length=80) Species: 3702 (Arabidopsis thaliana)

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLWHETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 7wg5 Chain AC Residue 102

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7wg5 Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
• Resolution: 3.89 Å
• Binding residue (original residue number in PDB): C11 G13 C14 T15 Q16 C17 C58 P59 S64 V65
• Binding residue (residue number reindexed from 1): C10 G12 C13 T14 Q15 C16 C57 P58 S63 V64
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009533 chloroplast stromal thylakoid
• GO:0009534 chloroplast thylakoid
• GO:0009535 chloroplast thylakoid membrane
• GO:0009536 plastid
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7wg5, PDBe:7wg5, PDBj:7wg5
• PDBsum: 7wg5
• PubMed: 35123031
• UniProt: P62090|PSAC_ARATH Photosystem I iron-sulfur center (Gene Name=psaC)