Structure of PDB 4v6z Chain AC Binding Site BS02

Receptor Information
>4v6z Chain AC (length=206) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6z Energy barriers and driving forces in tRNA translocation through the ribosome.
Resolution12.0 Å
Binding residue
(original residue number in PDB)		M128 R130 G158 A159 E160 I161 E165
Binding residue
(residue number reindexed from 1)		M128 R130 G158 A159 E160 I161 E165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4v6z, PDBe:4v6z, PDBj:4v6z
PDBsum4v6z
PubMed24186064
UniProtP0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]