Structure of PDB 6vmi Chain AB Binding Site BS02

Receptor Information

>6vmi Chain AB (length=220) Species: 9606 (Homo sapiens)

TDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPY
IFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLI
ENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEP
HVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQT
AITRAKEKRQQVEALYRLQG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6vmi Chain AB Residue 300

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
• Resolution: 2.96 Å
• Binding residue (original residue number in PDB): H197 T198 L199
• Binding residue (residue number reindexed from 1): H142 T143 L144
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation
• GO:0061668 mitochondrial ribosome assembly

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
• PDBsum: 6vmi
• PubMed: 32737313
• UniProt: Q9Y399|RT02_HUMAN Small ribosomal subunit protein uS2m (Gene Name=MRPS2)