Structure of PDB 8qkt Chain AAA Binding Site BS02

Receptor Information
>8qkt Chain AAA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8qkt Chain JJJ (length=167) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttttttttttcacaatcccggtgccgaggccgctcaattggtcgtag
acagctctagcaccgcttaaacgcacgtacggattccgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tgtgaaaaaaaaaagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qkt Engineering nucleosomes for generating diverse chromatin assemblies.
Resolution3.261 Å
Binding residue
(original residue number in PDB)		Y41 P43 G44 V46 A47 R49 K64 L65 P66 R69
Binding residue
(residue number reindexed from 1)		Y4 P6 G7 V9 A10 R12 K27 L28 P29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8qkt, PDBe:8qkt, PDBj:8qkt
PDBsum8qkt
PubMed
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]