Structure of PDB 6hiv Chain A9 Binding Site BS02

Receptor Information
>6hiv Chain A9 (length=53) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQMVMSRDELKLRCEYCRFEWIHDTLCVRCPAQPSHDQREMWLHSTWMWG
KQQ
Ligand information
>6hiv Chain UE (length=22) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPPPPPPPPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		R76 E78 R87
Binding residue
(residue number reindexed from 1)		R18 E20 R29
Enzymatic activity
Enzyme Commision number ?
External links