Structure of PDB 6yxy Chain A8 Binding Site BS02

Receptor Information
>6yxy Chain A8 (length=142) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKMGCEEITRKARRVQLQPTEYLAQHRMQVWQLRFKEMGPPFSRVWVALG
GKMRRRRVGRQVDVKDMRYYWRPIEPQYQRLYMSRLRIRDHSNKLRQPMR
LRATNADIGSGSSSIEWERASNRKYGAMLAPPKRQDFEFRVV
Ligand information
>6yxy Chain UM (length=8) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yxy Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
P58 T59
Binding residue
(residue number reindexed from 1)
P19 T20
Enzymatic activity
Enzyme Commision number ?
External links