Structure of PDB 6hiv Chain A8 Binding Site BS02

Receptor Information
>6hiv Chain A8 (length=142) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKMGCEEITRKARRVQLQPTEYLAQHRMQVWQLRFKEMGPPFSRVWVALG
GKMRRRRVGRQVDVKDMRYYWRPIEPQYQRLYMSRLRIRDHSNKLRQPMR
LRATNADIGSGSSSIEWERASNRKYGAMLAPPKRQDFEFRVV
Ligand information
>6hiv Chain UX (length=8) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		P58 T59
Binding residue
(residue number reindexed from 1)		P19 T20
Enzymatic activity
Enzyme Commision number ?
External links