Structure of PDB 5ib8 Chain A8 Binding Site BS02

Receptor Information

>5ib8 Chain A8 (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>5ib8 Chain 16 (length=122)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga

..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5ib8 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
• Resolution: 3.13 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 L54 A55 K59 N61 K62 T63 H95 G96 R97
• Binding residue (residue number reindexed from 1): R14 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 G44 V45 T46 S49 L53 A54 K58 N60 K61 T62 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ib8, PDBe:5ib8, PDBj:5ib8
• PDBsum: 5ib8
• PubMed: 27174928
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)