Structure of PDB 4wzo Chain A8 Binding Site BS02

Receptor Information
>4wzo Chain A8 (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF
Ligand information
>4wzo Chain 16 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga
...<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wzo Structural insights into the translational infidelity mechanism.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 V46 T47 S50 L54 A55 N61 K62 T63 Y92 K93 H95 R97
Binding residue
(residue number reindexed from 1)
R14 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 V45 T46 S49 L53 A54 N60 K61 T62 Y91 K92 H94 R96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum4wzo
PubMed26037619
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]