Structure of PDB 8wl2 Chain A7 Binding Site BS02

Receptor Information
>8wl2 Chain A7 (length=121) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRVALTLTSSHHIPAAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLK
YQMGLTVLGSQLKGMMNVLQG
Ligand information
>8wl2 Chain BK (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wl2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q39 Y87 R88 V89 D91 S94 L95 G97
Binding residue
(residue number reindexed from 1)		Q37 Y72 R73 V74 D76 S79 L80 G82
External links
PDB RCSB:8wl2, PDBe:8wl2, PDBj:8wl2
PDBsum8wl2
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]