Structure of PDB 8woe Chain A6 Binding Site BS02

Receptor Information
>8woe Chain A6 (length=134) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDM
DRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQG
Ligand information
>8woe Chain BI (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8woe Cryo-EM structure of the intact flagellar motor-hook complex in the CW state
Resolution4.3 Å
Binding residue
(original residue number in PDB)		Q39 L86 Y87 V89 S94 R104
Binding residue
(residue number reindexed from 1)		Q37 L84 Y85 V87 S92 R102
External links
PDB RCSB:8woe, PDBe:8woe, PDBj:8woe
PDBsum8woe
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]