Structure of PDB 8ove Chain A5 Binding Site BS02

Receptor Information

>8ove Chain A5 (length=186) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTKLGPRRVSPVRARGG
NFKLRGLRLDTGNFAWGTEASAQRARILDVVYNATSNELVRTKTLVKNCI
VVVDAAPFRLWYAKHYGIDLDVKKASSKLKRKWEYRRKHHKIEKALADQL
REGRLLARITSRPGQTGRADGALLEGAELQFYLKKL

Ligand information

>8ove Chain BH (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugucccucuccaaacgagaguacaugcaugggcuggcaugagcggcacgc
uccauggggcucgaggggcaccgucccgaggcgcugaaccuugaugcuug
gaaucaugcucagggacu

.<<<<<.<<<.......>>>.....<<<<<<<<.<<.....<<<....<.
<<<...>>>.>....<<<......>>>....>>>....>>.....>>>..
....>>>>>...>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R77 R92 R183
Binding residue (residue number reindexed from 1)	R76 R91 R154

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0042301	phosphate ion binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q57YL6

[Back to BioLiP]