Structure of PDB 3jbn Chain A3 Binding Site BS02

Receptor Information

>3jbn Chain A3 (length=119) Species: 36329 (Plasmodium falciparum 3D7)

NVKAYELRTLKKKELLDKLDELKKELSGLRISKALGNSAKNSKIHGVRKN
VARVLTVYNQKRKMELRQLYKNKKFKPYNLRKKLTKNKRLQLSPKQKAAM
TLRQKKKVQNFPQRKYLVV

Ligand information

>3jbn Chain AC (length=151)

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
<<<....>>>>.....(.<<<<.....>>..........>>>>..)...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
• Resolution: 4.7 Å
• Binding residue (original residue number in PDB): K5 Y7 R10 K13 K14 K15 K35 N43 S44 K45 H47 R50 K51 A54 R55 L57 T58 Y60 N61 Q62 R64 K65 R69 Y80 N81 K85 T87 K88 N89 R91
• Binding residue (residue number reindexed from 1): K3 Y5 R8 K11 K12 K13 K33 N41 S42 K43 H45 R48 K49 A52 R53 L55 T56 Y58 N59 Q60 R62 K63 R67 Y78 N79 K83 T85 K86 N87 R89

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
• PDBsum: 3jbn
• PubMed: 26432834
• UniProt: Q8IIB4