Structure of PDB 7ls2 Chain A1 Binding Site BS02

Receptor Information
>7ls2 Chain A1 (length=222) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMAR
KAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLN
KASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIA
RSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTH
FVEGGDAGNREDQINRLIRRMN
Ligand information
>7ls2 Chain B2 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R156 K244 T246 V250 E251
Binding residue
(residue number reindexed from 1)		R108 K196 T198 V202 E203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0042802 identical protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
PDBsum7ls2
PubMed34815424
UniProtP14148|RL7_MOUSE Large ribosomal subunit protein uL30 (Gene Name=Rpl7)

[Back to BioLiP]