Structure of PDB 8woe Chain A0 Binding Site BS02

Receptor Information
>8woe Chain A0 (length=123) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVGVALTLTSSHHIPAQAVVDLLYRVPDQPSLDGNTVDMDRERTQFADNS
LKYQMGLTVLGSQLKGMMNVLQG
Ligand information
>8woe Chain BQ (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8woe Cryo-EM structure of the intact flagellar motor-hook complex in the CW state
Resolution4.3 Å
Binding residue
(original residue number in PDB)		D44 L86 Y87 V89 D91 S94 L95 R104
Binding residue
(residue number reindexed from 1)		D42 L73 Y74 V76 D78 S81 L82 R91
External links
PDB RCSB:8woe, PDBe:8woe, PDBj:8woe
PDBsum8woe
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]