Structure of PDB 8wlt Chain A0 Binding Site BS02

Receptor Information
>8wlt Chain A0 (length=123) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVGVALTLTSSHHIPAQAVVDLLYRVPDQPSLDGNTVDMDRERTQFADNS
LKYQMGLTVLGSQLKGMMNVLQG
Ligand information
>8wlt Chain BQ (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wlt Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state
Resolution4.1 Å
Binding residue
(original residue number in PDB)		Y87 V89 D91
Binding residue
(residue number reindexed from 1)		Y74 V76 D78
External links
PDB RCSB:8wlt, PDBe:8wlt, PDBj:8wlt
PDBsum8wlt
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]