Structure of PDB 9fgq Chain A Binding Site BS02

Receptor Information
>9fgq Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>9fgq Chain J (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggatgtatatatctgacacgtgcctggagactagggagtaatccccttg
gcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fgq Spatial control of the APC/C ensures the rapid degradation of Cyclin B1
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R40 Y41 P43 G44 V46 R49 L65 R69
Binding residue
(residue number reindexed from 1)		R2 Y3 P5 G6 V8 R11 L27 R31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fgq, PDBe:9fgq, PDBj:9fgq
PDBsum9fgq
PubMed39143240
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]