Structure of PDB 9bdw Chain A Binding Site BS02

Receptor Information

>9bdw Chain A (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYT
GPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLG
IQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRD
PAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCD
KVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVR
VSMQLRRPSDRELSEPMEFQYLPDTD

Ligand information

>9bdw Chain D (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atcactggaacttcccagt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9bdw Transient interactions modulate affinity of NF-kappaB transcription factors for DNA
Resolution	1.87 Å
Binding residue (original residue number in PDB)	Y36 C38 E39 K122 K123 R187 K221 R246 Q247
Binding residue (residue number reindexed from 1)	Y19 C21 E22 K105 K106 R170 K204 R229 Q230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:9bdw, PDBe:9bdw, PDBj:9bdw
PDBsum	9bdw
PubMed	38805268
UniProt	Q04207\|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]