Structure of PDB 8ytd Chain A Binding Site BS02

Receptor Information
>8ytd Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFT
EFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMD
NP
Ligand information
>8ytd Chain C (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FKSVSYWGFGRLSYYNH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ytd Discovery and Hit to Lead Optimization of Macrocyclic Peptides as Novel Tropomyosin Receptor Kinase A Antagonists.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		V321 L322 N323 T325 F327 I328 Q350 V354 N355
Binding residue
(residue number reindexed from 1)		V41 L42 N43 T45 F47 I48 Q70 V74 N75
External links
PDB RCSB:8ytd, PDBe:8ytd, PDBj:8ytd
PDBsum8ytd
PubMed38950284
UniProtP04629|NTRK1_HUMAN High affinity nerve growth factor receptor (Gene Name=NTRK1)

[Back to BioLiP]