Structure of PDB 8vn2 Chain A Binding Site BS02

Receptor Information
>8vn2 Chain A (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vn2 Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution1.63 Å
Binding residue
(original residue number in PDB)
N57 R61 Q63 R74 G76 T95 A96 S97 H98 L116 N119 N123
Binding residue
(residue number reindexed from 1)
N56 R60 Q62 R73 G75 T94 A95 S96 H97 L115 N118 N122
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8vn2, PDBe:8vn2, PDBj:8vn2
PDBsum8vn2
PubMed
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]