Structure of PDB 8v7l Chain A Binding Site BS02

Receptor Information
>8v7l Chain A (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVM
ALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8v7l Chain J (length=140) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v7l Functionalized graphene-oxide grids enable high-resolution cryo-EM structures of the SNF2h-nucleosome complex without crosslinking.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R72 R83 F84 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R32 R43 F44 V77 T78 M80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8v7l, PDBe:8v7l, PDBj:8v7l
PDBsum8v7l
PubMed38472177
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]