Structure of PDB 8uhl Chain A Binding Site BS02

Receptor Information
>8uhl Chain A (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIK
EPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRH
RACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uhl Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains.
Resolution1.92 Å
Binding residue
(original residue number in PDB)
E962 F966 D969 A1064 A1065 E1066 D1068 P1069 F1071
Binding residue
(residue number reindexed from 1)
E12 F16 D19 A114 A115 E116 D118 P119 F121
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8uhl, PDBe:8uhl, PDBj:8uhl
PDBsum8uhl
PubMed38733345
UniProtQ9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B (Gene Name=ATAD2B)

[Back to BioLiP]