Structure of PDB 8u6x Chain A Binding Site BS02

Receptor Information

>8u6x Chain A (length=247) Species: 528354 (Neisseria gonorrhoeae MS11)

ADLMLAQEYKGQDIAGWAMSEKLDGVRAYWDGKHLISRQGYAFTPPKGFT
AQFPPYPLDGELYSGRGQFEQISATVRSVSSDWRGIRLHVFDVPKAQGNL
YQRLAVATQWLKTHPNAPITIIPQIKVRDRRHAMDFLKQIEAQGGEGVML
RQPESRYSGGRSSQLLKLKSQYDDECTVTRHYEGKGRNAGRLGAVGCKNR
HGEFRIGSGFKDKDRDNPPKIGTLITYRYRGFTRKGTPKFATFVRVR

Ligand information

>8u6x Chain C (length=6)

ctatcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8u6x A role for the ATP-dependent DNA ligase lig E of Neisseria gonorrhoeae in biofilm formation.
• Resolution: 2.44 Å
• Binding residue (original residue number in PDB): G184 K185 R187 N188 G193 R205 K239 F240
• Binding residue (residue number reindexed from 1): G184 K185 R187 N188 G193 R205 K239 F240

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Apr 18 01:53:28 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8u6x', asym_id = 'A', bs = 'BS02', title = 'A role for the ATP-dependent DNA ligase lig E of Neisseria gonorrhoeae in biofilm formation.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8u6x', asym_id='A', bs='BS02', title='A role for the ATP-dependent DNA ligase lig E of Neisseria gonorrhoeae in biofilm formation.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003910,0005524,0006281,0006310', uniprot = '', pdbid = '8u6x', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003910,0005524,0006281,0006310', uniprot='', pdbid='8u6x', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>