Structure of PDB 8tlo Chain A Binding Site BS02

Receptor Information
>8tlo Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMK
THGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlo Crystal Structure Analysis of BCL11A in complex with DNA
Resolution2.76 Å
Binding residue
(original residue number in PDB)
N753 S755 S783
Binding residue
(residue number reindexed from 1)
N13 S15 S43
External links
PDB RCSB:8tlo, PDBe:8tlo, PDBj:8tlo
PDBsum8tlo
PubMed
UniProtQ9H165|BC11A_HUMAN B-cell lymphoma/leukemia 11A (Gene Name=BCL11A)

[Back to BioLiP]