Structure of PDB 8tll Chain A Binding Site BS02

Receptor Information
>8tll Chain A (length=103) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTLPHIIRPVEEVTEEEIRNICSNSREKIYNRSLGSTCHQCRQKTTDTKT
NCRNPDCWGIRGQFCGPCLRNRYGEEVKDALLDPNWHCPPCRGICNCSFC
RQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tll The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		T257 E258
Binding residue
(residue number reindexed from 1)		T14 E15
External links
PDB RCSB:8tll, PDBe:8tll, PDBj:8tll
PDBsum8tll
PubMed38168392
UniProtQ9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7 (Gene Name=Cdca7)

[Back to BioLiP]