Structure of PDB 8t33 Chain A Binding Site BS02

Receptor Information
>8t33 Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain8t33 Chain A Residue 206 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t33 Structural and functional characterization of the role of acetylation on the interactions of the human Atg8-family proteins with the autophagy receptor TP53INP2/DOR.
Resolution1.599 Å
Binding residue
(original residue number in PDB)		E97 H98
Binding residue
(residue number reindexed from 1)		E97 H98
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000226 microtubule cytoskeleton organization
GO:0000422 autophagy of mitochondrion
GO:0006605 protein targeting
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006995 cellular response to nitrogen starvation
GO:0007268 chemical synaptic transmission
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031 protein transport
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020 regulation of Rac protein signal transduction
GO:0097352 autophagosome maturation
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524 positive regulation of protein K48-linked ubiquitination
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005790 smooth endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0097225 sperm midpiece
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t33, PDBe:8t33, PDBj:8t33
PDBsum8t33
PubMed38726830
UniProtO95166|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)

[Back to BioLiP]