Structure of PDB 8t11 Chain A Binding Site BS02

Receptor Information
>8t11 Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEINTKEVAQRITAELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSK
LKSGRETFRRMWKWLQEPEFQRMSALFTDLQRRTLFAIFKENKRPSKEMQ
ITISQQLGLELTTVSNFFMNARAASL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t11 Crystal structure of the PEG10 promoter-bound ONECUT2 R479A/R480A mutant DNA-binding domain
Resolution2.91 Å
Binding residue
(original residue number in PDB)		R363 S364 T367 L381 S383 G384 R450
Binding residue
(residue number reindexed from 1)		R33 S34 T37 L51 S53 G54 R94
External links
PDB RCSB:8t11, PDBe:8t11, PDBj:8t11
PDBsum8t11
PubMed
UniProtO95948|ONEC2_HUMAN One cut domain family member 2 (Gene Name=ONECUT2)

[Back to BioLiP]