Structure of PDB 8t0f Chain A Binding Site BS02

Receptor Information
>8t0f Chain A (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEINTKEVAQRITAELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSK
LKSGRETFRRMWKWLQEPEFQRMSALRLSRLVFTDLQRRTLFAIFKENKR
PSKEMQITISQQLGLELTTVSNFFMNARRRSLEKW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t0f Crystal structure of the PEG10 promoter-bound ONECUT2 DNA-binding domain
Resolution2.61 Å
Binding residue
(original residue number in PDB)		R363 S364 G366 T367 K376 L381 K382 S383 G384 T387 S429 R430 R450 M475 R479
Binding residue
(residue number reindexed from 1)		R33 S34 G36 T37 K46 L51 K52 S53 G54 T57 S79 R80 R100 M125 R129
External links
PDB RCSB:8t0f, PDBe:8t0f, PDBj:8t0f
PDBsum8t0f
PubMed
UniProtO95948|ONEC2_HUMAN One cut domain family member 2 (Gene Name=ONECUT2)

[Back to BioLiP]