Structure of PDB 8swb Chain A Binding Site BS02

Receptor Information
>8swb Chain A (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAE
IHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGK
EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSE
Ligand information
>8swb Chain D (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccucacucacccacucgcca
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8swb Crystal structure of RNase H/RNA/PS-ASO complex at an atomic level
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N151 G152 T181 N182 Q183 F213 W221 W225 T232 S233 V238 I239 N240
Binding residue
(residue number reindexed from 1)		N15 G16 T45 N46 Q47 F77 W85 W89 T96 S97 V102 I103 N104
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
External links
PDB RCSB:8swb, PDBe:8swb, PDBj:8swb
PDBsum8swb
PubMed
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]